Lineage for d5jg6c_ (5jg6 C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2933104Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2933105Protein automated matches [190233] (31 species)
    not a true protein
  7. 2933161Species Human (Homo sapiens) [TaxId:9606] [187090] (156 PDB entries)
  8. 2933257Domain d5jg6c_: 5jg6 C: [318617]
    Other proteins in same PDB: d5jg6b2
    automated match to d5hpte_
    complexed with zn

Details for d5jg6c_

PDB Entry: 5jg6 (more details), 2 Å

PDB Description: apc11-ubv shows role of noncovalent ring-ubiquitin interactions in processive multiubiquitination and ubiquitin chain elongation by apc/c
PDB Compounds: (C:) Polyubiquitin-B

SCOPe Domain Sequences for d5jg6c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jg6c_ d.15.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqilvktprgktitlevepsdtienvkakiqdkegippdqqilffavkrledgrtlsdyn
iqkksslllamrvpg

SCOPe Domain Coordinates for d5jg6c_:

Click to download the PDB-style file with coordinates for d5jg6c_.
(The format of our PDB-style files is described here.)

Timeline for d5jg6c_: