| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
| Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
| Protein automated matches [190233] (31 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187090] (156 PDB entries) |
| Domain d5jg6c_: 5jg6 C: [318617] Other proteins in same PDB: d5jg6b2 automated match to d5hpte_ complexed with zn |
PDB Entry: 5jg6 (more details), 2 Å
SCOPe Domain Sequences for d5jg6c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jg6c_ d.15.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqilvktprgktitlevepsdtienvkakiqdkegippdqqilffavkrledgrtlsdyn
iqkksslllamrvpg
Timeline for d5jg6c_: