| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
| Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
| Protein automated matches [193445] (6 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [193446] (46 PDB entries) |
| Domain d5ja4a_: 5ja4 A: [318614] Other proteins in same PDB: d5ja4b_ automated match to d4uuza_ complexed with gol, mes |
PDB Entry: 5ja4 (more details), 2.42 Å
SCOPe Domain Sequences for d5ja4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ja4a_ a.22.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
stellirklpfqrlvreiaqdfktdlrfqsaaigalqeaseaylvglfedtnlcaihakr
vtimpkdiqlarrirger
Timeline for d5ja4a_: