Lineage for d5ja4a_ (5ja4 A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. Protein automated matches [193445] (8 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [193446] (78 PDB entries)
  8. Domain d5ja4a_: 5ja4 A: [318614]
    Other proteins in same PDB: d5ja4b_
    automated match to d4uuza_
    complexed with gol, mes

Details for d5ja4a_

PDB Entry: 5ja4 (more details), 2.42 Å

PDB Description: crystal structure of human tonsl and mcm2 hbds binding to a histone h3-h4 tetramer
PDB Compounds: (A:) Histone H3.3

SCOPe Domain Sequences for d5ja4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ja4a_ a.22.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
stellirklpfqrlvreiaqdfktdlrfqsaaigalqeaseaylvglfedtnlcaihakr
vtimpkdiqlarrirger

SCOPe Domain Coordinates for d5ja4a_ are not available.

Timeline for d5ja4a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5ja4b_