| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.1: Ferritin [47241] (10 proteins) |
| Protein automated matches [190041] (34 species) not a true protein |
| Species Escherichia coli [TaxId:536056] [318611] (1 PDB entry) |
| Domain d4ztta_: 4ztt A: [318612] Other proteins in same PDB: d4zttb2, d4ztte2, d4zttf2 automated match to d4reua_ complexed with fe, fe2, feo, gol, o, oh, oxy, per; mutant |
PDB Entry: 4ztt (more details), 1.83 Å
SCOPe Domain Sequences for d4ztta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ztta_ a.25.1.1 (A:) automated matches {Escherichia coli [TaxId: 536056]}
lkpemieklneqmnlelyasllyqqmsawcsyhtfegaaaflrrhaqeemthmqrlfdyl
tdtgnlprintvespfaeyssldelfqetykheqlitqkinelahaamtnqdyptfnflq
wyvseqheeeklfksiidklslagksgeglyfidkelstldt
Timeline for d4ztta_: