Lineage for d1qhib_ (1qhi B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22942Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 22943Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) (S)
  5. 22944Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (8 protein domains)
  6. 23000Protein Thymidine kinase [52552] (1 species)
  7. 23001Species Herpes simplex virus type 1, different strains [TaxId:10298] [52553] (17 PDB entries)
  8. 23009Domain d1qhib_: 1qhi B: [31861]

Details for d1qhib_

PDB Entry: 1qhi (more details), 1.9 Å

PDB Description: herpes simplex virus type-i thymidine kinase complexed with a novel non-substrate inhibitor, 9-(4-hydroxybutyl)-n2-phenylguanine

SCOP Domain Sequences for d1qhib_:

Sequence, based on SEQRES records: (download)

>d1qhib_ c.37.1.1 (B:) Thymidine kinase {Herpes simplex virus type 1, different strains}
mptllrvyidgphgmgkttttqllvalgsrddivyvpepmtywrvlgasetianiyttqh
rldqgeisagdaavvmtsaqitmgmpyavtdavlaphiggeagsshapppaltlifdrhp
iaallcypaarylmgsmtpqavlafvalipptlpgtnivlgalpedrhidrlakrqrpge
rldlamlaairrvygllantvrylqcggswredwgqlsgtavppqgaepqsnagprphig
dtlftlfrapellapngdlynvfawaldvlakrlrsmhvfildydqspagcrdallqlts
gmvqthvttpgsipticdlartfaremgea

Sequence, based on observed residues (ATOM records): (download)

>d1qhib_ c.37.1.1 (B:) Thymidine kinase {Herpes simplex virus type 1, different strains}
mptllrvyidgphgmgkttttqllvalgdivyvpepmtywrvlgasetianiyttqhrld
qgeisagdaavvmtsaqitmgmpyavtdavlaphiggeagppaltlifdrhpiaallcyp
aarylmgsmtpqavlafvalipptlpgtnivlgalpedrhidrlakrqrpgerldlamla
airrvygllantvrylqcggswredwgqlsagprphigdtlftlfrapellapngdlynv
fawaldvlakrlrsmhvfildydqspagcrdallqltsgmvqthvttpgsipticdlart
faremgea

SCOP Domain Coordinates for d1qhib_:

Click to download the PDB-style file with coordinates for d1qhib_.
(The format of our PDB-style files is described here.)

Timeline for d1qhib_: