Lineage for d5jpub_ (5jpu B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542783Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2543372Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2543932Family d.17.4.8: Limonene-1,2-epoxide hydrolase-like [89854] (3 proteins)
    automatically mapped to Pfam PF07858
  6. 2544010Protein automated matches [190519] (2 species)
    not a true protein
  7. 2544014Species Rhodococcus erythropolis [TaxId:1833] [318559] (2 PDB entries)
  8. 2544016Domain d5jpub_: 5jpu B: [318608]
    automated match to d1nu3b_
    complexed with 3zq; mutant

Details for d5jpub_

PDB Entry: 5jpu (more details), 1.5 Å

PDB Description: structure of limonene epoxide hydrolase mutant - h-2-h5 complex with (s,s)-cyclohexane-1,2-diol
PDB Compounds: (B:) limonene epoxide hydrolase

SCOPe Domain Sequences for d5jpub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jpub_ d.17.4.8 (B:) automated matches {Rhodococcus erythropolis [TaxId: 1833]}
stpdekivlefmdaltsndaaklidyfaedtmyqnmplppaygrdaveqtlagffkvfsi
davetfhigstkglvytervdvlralptgksynvsvlgvfqltegkitgwrdyfdlre

SCOPe Domain Coordinates for d5jpub_:

Click to download the PDB-style file with coordinates for d5jpub_.
(The format of our PDB-style files is described here.)

Timeline for d5jpub_: