Lineage for d4uhlc1 (4uhl C:61-502)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2331668Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2331669Protein automated matches [190847] (73 species)
    not a true protein
  7. 2331745Species Human (Homo sapiens) [TaxId:9606] [196470] (41 PDB entries)
  8. 2331867Domain d4uhlc1: 4uhl C:61-502 [318606]
    Other proteins in same PDB: d4uhla2, d4uhlb2, d4uhlc2, d4uhld2, d4uhle2, d4uhlf2, d4uhlg2, d4uhlh2
    automated match to d3khma_
    complexed with hem, vfv

Details for d4uhlc1

PDB Entry: 4uhl (more details), 2.5 Å

PDB Description: human sterol 14-alpha demethylase (cyp51) in complex with vfv in p1 space group
PDB Compounds: (C:) Sterol 14-alpha demethylase

SCOPe Domain Sequences for d4uhlc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uhlc1 a.104.1.0 (C:61-502) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ppyifspipflghaiafgkspieflenayekygpvfsftmvgktftyllgsdaaallfns
knedlnaedvysrlttpvfgkgvaydvpnpvfleqkkmlksglniahfkqhvsiieketk
eyfeswgesgeknvfealseliiltashclhgkeirsqlnekvaqlyadldggfshaawl
lpgwlplpsfrrrdrahreikdifykaiqkrrqsqekiddilqtlldatykdgrpltdde
vagmliglllagqhtssttsawmgfflardktlqkkcyleqktvcgenlppltydqlkdl
nlldrciketlrlrppimimmrmartpqtvagytippghqvcvsptvnqrlkdswverld
fnpdrylqdnpasgekfayvpfgagrhrcigenfayvqiktiwstmlrlyefdlidgyfp
tvnyttmihtpenpvirykrrs

SCOPe Domain Coordinates for d4uhlc1:

Click to download the PDB-style file with coordinates for d4uhlc1.
(The format of our PDB-style files is described here.)

Timeline for d4uhlc1: