![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.26: SMAD/FHA domain [49878] (1 superfamily) sandwich; 11 strands in 2 sheets; greek-key |
![]() | Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) ![]() has a few short helices inserted in loops |
![]() | Family b.26.1.3: Interferon regulatory factor 3 (IRF3), transactivation domain [101630] (1 protein) weak sequence similarity to SMAD domain |
![]() | Protein Interferon regulatory factor 3 (IRF3), transactivation domain [101631] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [101632] (8 PDB entries) |
![]() | Domain d5jeka_: 5jek A: [318594] automated match to d3a77a_ |
PDB Entry: 5jek (more details), 2.4 Å
SCOPe Domain Sequences for d5jeka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jeka_ b.26.1.3 (A:) Interferon regulatory factor 3 (IRF3), transactivation domain {Human (Homo sapiens) [TaxId: 9606]} enplkrllvpgeewefevtafyrgrqvfqqtiscpeglrlvgsevgdrtlpgwpvtlpdp gmsltdrgvmsyvrhvlsclggglalwragqwlwaqrlghchtywavseellpnsghgpd gevpkdkeggvfdlgpfivdlitftegsgrspryalwfcvgeswpqdqpwtkrlvmvkvv ptclralvemarvggasslentvdlhisnshplsltsdqykaylqdlvegmdfq
Timeline for d5jeka_: