Lineage for d5cfda_ (5cfd A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2409884Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2410108Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2410109Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 protein domains)
    the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
    there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)
  6. 2410393Protein automated matches [190854] (15 species)
    not a true protein
  7. 2410477Species Saffold virus [TaxId:434309] [318368] (2 PDB entries)
  8. 2410478Domain d5cfda_: 5cfd A: [318593]
    automated match to d1tme1_

Details for d5cfda_

PDB Entry: 5cfd (more details), 2.5 Å

PDB Description: crystal structure of dtt treated human cardiovirus safv-3
PDB Compounds: (A:) vp1

SCOPe Domain Sequences for d5cfda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cfda_ b.121.4.1 (A:) automated matches {Saffold virus [TaxId: 434309]}
gvdnaekgkvsddnastdfvaepvklpenqtrvsffydrstlssvlqstsdvsskftpst
aknlqnsilltplpsdivnnsvlpeqerwisfaspttqkppyktkqdwnfimfspftyyk
cdlevtlskndretissvvryvpcgapsdlsdqtmpqtpsladtrdphmwvvgqgttnqi
sfvipytsplsvlpsvwfngfsnfdnssrfgvapnadfgrlllqgqgtfsvhyrykkmrv
fcprptvfipwp

SCOPe Domain Coordinates for d5cfda_:

Click to download the PDB-style file with coordinates for d5cfda_.
(The format of our PDB-style files is described here.)

Timeline for d5cfda_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5cfdb_