| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.153: Nuclear receptor coactivator interlocking domain [69124] (1 superfamily) 3 helices, non-globular array; forms interlocked heterodimers with its targets |
Superfamily a.153.1: Nuclear receptor coactivator interlocking domain [69125] (1 family) ![]() not a true superfamily |
| Family a.153.1.1: Nuclear receptor coactivator interlocking domain [69126] (4 proteins) |
| Protein automated matches [190180] (2 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [186918] (6 PDB entries) |
| Domain d5jemf_: 5jem F: [318587] automated match to d1zoqc_ |
PDB Entry: 5jem (more details), 2.5 Å
SCOPe Domain Sequences for d5jemf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jemf_ a.153.1.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
salqdllrtlkspsspqqqqqvlnilksnpqlmaafikqrta
Timeline for d5jemf_: