Lineage for d5jemf_ (5jem F:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2340821Fold a.153: Nuclear receptor coactivator interlocking domain [69124] (1 superfamily)
    3 helices, non-globular array; forms interlocked heterodimers with its targets
  4. 2340822Superfamily a.153.1: Nuclear receptor coactivator interlocking domain [69125] (1 family) (S)
    not a true superfamily
  5. 2340823Family a.153.1.1: Nuclear receptor coactivator interlocking domain [69126] (4 protein domains)
  6. 2340834Protein automated matches [190180] (2 species)
    not a true protein
  7. 2340835Species Human (Homo sapiens) [TaxId:9606] [186918] (2 PDB entries)
  8. 2340840Domain d5jemf_: 5jem F: [318587]
    automated match to d1zoqc_

Details for d5jemf_

PDB Entry: 5jem (more details), 2.5 Å

PDB Description: complex of irf-3 with cbp
PDB Compounds: (F:) creb-binding protein

SCOPe Domain Sequences for d5jemf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jemf_ a.153.1.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
salqdllrtlkspsspqqqqqvlnilksnpqlmaafikqrta

SCOPe Domain Coordinates for d5jemf_:

Click to download the PDB-style file with coordinates for d5jemf_.
(The format of our PDB-style files is described here.)

Timeline for d5jemf_: