SCOPe 2.06: Domain d5jroa1: 5jro A:1-201

Lineage for d5jroa1 (5jro A:1-201)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.3: Quinone reductase [52235] (4 proteins)
   binds FAD

6. Protein automated matches [190235] (2 species)
   not a true protein

7. Species Yersinia pestis [TaxId:214092] [195328] (2 PDB entries)

8. Domain d5jroa1: 5jro A:1-201 [318582]
   Other proteins in same PDB: d5jroa2, d5jrob2
   automated match to d1t5ba_
   complexed with gol

Details for d5jroa1

PDB Entry: 5jro, 2.54 Å

PDB Description: the crystal structure of azoreductase from yersinia pestis co92 in its apo form

PDB Compounds: (A:) FMN-dependent NADH-azoreductase

SCOPe Domain Sequences for d5jroa1:

Sequence, based on SEQRES records:

>d5jroa1 c.23.5.3 (A:1-201) automated matches {Yersinia pestis [TaxId: 214092]}
mskvlvlkssilatssqsnqladffveqwqaahagdqitvrdlaaqpipvldgelvgalr
psgtaltprqqealalsdeliaelqandviviaapmynfniptqlknyfdmiaragvtfr
ytekgpeglvtgkraiiltsrggihkdtptdlvvpylrlflgfigitdvefvfaegiayg
pevatkaqadaktllaqvvaa

Sequence, based on observed residues (ATOM records):

>d5jroa1 c.23.5.3 (A:1-201) automated matches {Yersinia pestis [TaxId: 214092]}
mskvlvlkssilatssqsnqladffveqwqaahagdqitvrdlaaqpipvldgelvgalr
pgtaltprqqealalsdeliaelqandviviaapmynfniptqlknyfdmiaragvtfry
tekgpeglvtgkraiiltsrgtptdlvvpylrlflgfigitdvefvfaegadaktllaqv
vaa

Timeline for d5jroa1:

• d5jroa1 is new in SCOPe 2.06-stable
  
• d5jroa1 appears in SCOPe 2.07
  
• d5jroa1 appears in the current release, SCOPe 2.08