Lineage for d5jroa1 (5jro A:1-201)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. Family c.23.5.3: Quinone reductase [52235] (4 proteins)
    binds FAD
  6. Protein automated matches [190235] (2 species)
    not a true protein
  7. Species Yersinia pestis [TaxId:214092] [195328] (2 PDB entries)
  8. Domain d5jroa1: 5jro A:1-201 [318582]
    Other proteins in same PDB: d5jroa2, d5jrob2
    automated match to d1t5ba_
    complexed with gol

Details for d5jroa1

PDB Entry: 5jro (more details), 2.54 Å

PDB Description: the crystal structure of azoreductase from yersinia pestis co92 in its apo form
PDB Compounds: (A:) FMN-dependent NADH-azoreductase

SCOPe Domain Sequences for d5jroa1:

Sequence, based on SEQRES records: (download)

>d5jroa1 c.23.5.3 (A:1-201) automated matches {Yersinia pestis [TaxId: 214092]}
mskvlvlkssilatssqsnqladffveqwqaahagdqitvrdlaaqpipvldgelvgalr
psgtaltprqqealalsdeliaelqandviviaapmynfniptqlknyfdmiaragvtfr
ytekgpeglvtgkraiiltsrggihkdtptdlvvpylrlflgfigitdvefvfaegiayg
pevatkaqadaktllaqvvaa

Sequence, based on observed residues (ATOM records): (download)

>d5jroa1 c.23.5.3 (A:1-201) automated matches {Yersinia pestis [TaxId: 214092]}
mskvlvlkssilatssqsnqladffveqwqaahagdqitvrdlaaqpipvldgelvgalr
pgtaltprqqealalsdeliaelqandviviaapmynfniptqlknyfdmiaragvtfry
tekgpeglvtgkraiiltsrgtptdlvvpylrlflgfigitdvefvfaegadaktllaqv
vaa

SCOPe Domain Coordinates for d5jroa1 are not available.

Timeline for d5jroa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5jroa2
View in 3D
Domains from other chains:
(mouse over for more information)
d5jrob1, d5jrob2