Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (309 species) not a true protein |
Species Aeropyrum pernix [TaxId:272557] [188386] (2 PDB entries) |
Domain d5b1yb_: 5b1y B: [318561] automated match to d1g0na_ complexed with ndp |
PDB Entry: 5b1y (more details), 2.09 Å
SCOPe Domain Sequences for d5b1yb_:
Sequence, based on SEQRES records: (download)
>d5b1yb_ c.2.1.0 (B:) automated matches {Aeropyrum pernix [TaxId: 272557]} mettyalvtggsrgigratvlrfaregwsvviayksradlaektaeearrlgspeaytvr vdvgdpdsvtemssrvgeliphlnvlvnaagvlqlggieetsiseweetlrvnltgvylv tklllpllrkakwasivnvasiagetgnvvagvaysaskagvigltkrlavqlagygirv navapsfvetdmtrsfldtpekreriaslhplkiilkpedvaeailfladprrsrgitgh vlsinagrrt
>d5b1yb_ c.2.1.0 (B:) automated matches {Aeropyrum pernix [TaxId: 272557]} mettyalvtggsrgigratvlrfaregwsvviayksradlaektaeearrlgspeaytvr vdvgdpdsvtemssrvgeliphlnvlvnaagvlqlggieetsiseweetlrvnltgvylv tklllpllrkakwasivnvasiagetgnvvagvaysaskagvigltkrlavqlagygirv navapsfvetdmtrsflriaslhplkiilkpedvaeailfladprrsrgitghvlsinag rrt
Timeline for d5b1yb_: