Lineage for d5b1yb_ (5b1y B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2426096Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2426097Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2430344Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2430345Protein automated matches [190069] (247 species)
    not a true protein
  7. 2430374Species Aeropyrum pernix [TaxId:272557] [188386] (2 PDB entries)
  8. 2430378Domain d5b1yb_: 5b1y B: [318561]
    automated match to d1g0na_
    complexed with ndp

Details for d5b1yb_

PDB Entry: 5b1y (more details), 2.09 Å

PDB Description: crystal structure of nadph bound carbonyl reductase from aeropyrum pernix
PDB Compounds: (B:) 3-oxoacyl-[acyl-carrier-protein] reductase

SCOPe Domain Sequences for d5b1yb_:

Sequence, based on SEQRES records: (download)

>d5b1yb_ c.2.1.0 (B:) automated matches {Aeropyrum pernix [TaxId: 272557]}
mettyalvtggsrgigratvlrfaregwsvviayksradlaektaeearrlgspeaytvr
vdvgdpdsvtemssrvgeliphlnvlvnaagvlqlggieetsiseweetlrvnltgvylv
tklllpllrkakwasivnvasiagetgnvvagvaysaskagvigltkrlavqlagygirv
navapsfvetdmtrsfldtpekreriaslhplkiilkpedvaeailfladprrsrgitgh
vlsinagrrt

Sequence, based on observed residues (ATOM records): (download)

>d5b1yb_ c.2.1.0 (B:) automated matches {Aeropyrum pernix [TaxId: 272557]}
mettyalvtggsrgigratvlrfaregwsvviayksradlaektaeearrlgspeaytvr
vdvgdpdsvtemssrvgeliphlnvlvnaagvlqlggieetsiseweetlrvnltgvylv
tklllpllrkakwasivnvasiagetgnvvagvaysaskagvigltkrlavqlagygirv
navapsfvetdmtrsflriaslhplkiilkpedvaeailfladprrsrgitghvlsinag
rrt

SCOPe Domain Coordinates for d5b1yb_:

Click to download the PDB-style file with coordinates for d5b1yb_.
(The format of our PDB-style files is described here.)

Timeline for d5b1yb_: