Class b: All beta proteins [48724] (177 folds) |
Fold b.26: SMAD/FHA domain [49878] (1 superfamily) sandwich; 11 strands in 2 sheets; greek-key |
Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) has a few short helices inserted in loops |
Family b.26.1.3: Interferon regulatory factor 3 (IRF3), transactivation domain [101630] (1 protein) weak sequence similarity to SMAD domain |
Protein Interferon regulatory factor 3 (IRF3), transactivation domain [101631] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [101632] (8 PDB entries) |
Domain d5jere_: 5jer E: [318558] automated match to d3a77a_ |
PDB Entry: 5jer (more details), 2.91 Å
SCOPe Domain Sequences for d5jere_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jere_ b.26.1.3 (E:) Interferon regulatory factor 3 (IRF3), transactivation domain {Human (Homo sapiens) [TaxId: 9606]} enplkrllvpgeewefevtafyrgrqvfqqtiscpeglrlvgsevgdrtlpgwpvtlpdp gmsltdrgvmsyvrhvlsclggglalwragqwlwaqrlghchtywavseellpnsghgpd gevpkdkeggvfdlgpfivdlitftegsgrspryalwfcvgeswpqdqpwtkrlvmvkvv ptclralvemarvggasslentvdlhisnshplsltsdqykaylqdlvegmdfq
Timeline for d5jere_: