Lineage for d5jeja_ (5jej A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778062Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. 2778063Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) (S)
    has a few short helices inserted in loops
  5. 2778180Family b.26.1.3: Interferon regulatory factor 3 (IRF3), transactivation domain [101630] (1 protein)
    weak sequence similarity to SMAD domain
  6. 2778181Protein Interferon regulatory factor 3 (IRF3), transactivation domain [101631] (1 species)
  7. 2778182Species Human (Homo sapiens) [TaxId:9606] [101632] (8 PDB entries)
  8. 2778193Domain d5jeja_: 5jej A: [318543]
    automated match to d3a77a_

Details for d5jeja_

PDB Entry: 5jej (more details), 2 Å

PDB Description: phosphorylated sting in complex with irf-3 ctd
PDB Compounds: (A:) Interferon regulatory factor 3

SCOPe Domain Sequences for d5jeja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jeja_ b.26.1.3 (A:) Interferon regulatory factor 3 (IRF3), transactivation domain {Human (Homo sapiens) [TaxId: 9606]}
enplkrllvpgeewefevtafyrgrqvfqqtiscpeglrlvgsevgdrtlpgwpvtlpdp
gmsltdrgvmsyvrhvlsclggglalwragqwlwaqrlghchtywavseellpnsghgpd
gevpkdkeggvfdlgpfivdlitftegsgrspryalwfcvgeswpqdqpwtkrlvmvkvv
ptclralvemarvggasslentvdlhisnshplsltsdqykaylqdlvegmdfq

SCOPe Domain Coordinates for d5jeja_:

Click to download the PDB-style file with coordinates for d5jeja_.
(The format of our PDB-style files is described here.)

Timeline for d5jeja_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5jejb_