| Class b: All beta proteins [48724] (180 folds) |
| Fold b.26: SMAD/FHA domain [49878] (1 superfamily) sandwich; 11 strands in 2 sheets; greek-key |
Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) ![]() has a few short helices inserted in loops |
| Family b.26.1.3: Interferon regulatory factor 3 (IRF3), transactivation domain [101630] (1 protein) weak sequence similarity to SMAD domain |
| Protein Interferon regulatory factor 3 (IRF3), transactivation domain [101631] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [101632] (8 PDB entries) |
| Domain d5jeja_: 5jej A: [318543] automated match to d3a77a_ |
PDB Entry: 5jej (more details), 2 Å
SCOPe Domain Sequences for d5jeja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jeja_ b.26.1.3 (A:) Interferon regulatory factor 3 (IRF3), transactivation domain {Human (Homo sapiens) [TaxId: 9606]}
enplkrllvpgeewefevtafyrgrqvfqqtiscpeglrlvgsevgdrtlpgwpvtlpdp
gmsltdrgvmsyvrhvlsclggglalwragqwlwaqrlghchtywavseellpnsghgpd
gevpkdkeggvfdlgpfivdlitftegsgrspryalwfcvgeswpqdqpwtkrlvmvkvv
ptclralvemarvggasslentvdlhisnshplsltsdqykaylqdlvegmdfq
Timeline for d5jeja_: