Lineage for d5bywc_ (5byw C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2441004Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2441005Protein automated matches [190075] (125 species)
    not a true protein
  7. 2441209Species Clostridium thermocellum [TaxId:203119] [269902] (4 PDB entries)
  8. 2441216Domain d5bywc_: 5byw C: [318539]
    automated match to d3amda_

Details for d5bywc_

PDB Entry: 5byw (more details), 2.6 Å

PDB Description: crystal structure of engineered trifunctional ctcel5e
PDB Compounds: (C:) endoglucanase h

SCOPe Domain Sequences for d5bywc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bywc_ c.1.8.0 (C:) automated matches {Clostridium thermocellum [TaxId: 203119]}
vdpfemvrkmgmgtnlgntleapyegswsksameyyfddfkaagyknvripvrwdnhtmr
typytidkafldrveqvvdwslsrgfvtiinshhddwikedyngnierfekiweqiaerf
knksenllfeimnepfgnitdeqiddmnsrilkiirktnptriviigggywnsyntlvni
kipddpyligtahyydpfefthqgaewvegsekwlgrkwgtqedmdtvvrvfdfvkswsd
rnnipvyfgefavmayadrtsrvkwydfisdaalergfacsvwdngvfgsldndmaiynr
dtrtfdteilnalfnpgt

SCOPe Domain Coordinates for d5bywc_:

Click to download the PDB-style file with coordinates for d5bywc_.
(The format of our PDB-style files is described here.)

Timeline for d5bywc_: