SCOPe 2.08: Domain d5c70a2: 5c70 A:181-275

Lineage for d5c70a2 (5c70 A:181-275)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families)

5. Family b.1.4.0: automated matches [254272] (1 protein)
   not a true family

6. Protein automated matches [254633] (19 species)
   not a true protein

7. Species Fungus (Aspergillus oryzae) [TaxId:5062] [318527] (2 PDB entries)

8. Domain d5c70a2: 5c70 A:181-275 [318537]
   Other proteins in same PDB: d5c70a1, d5c70a3, d5c70b1, d5c70b3
   automated match to d5czkb2

Details for d5c70a2

PDB Entry: 5c70, 3.1 Å

PDB Description: the structure of aspergillus oryzae beta-glucuronidase

PDB Compounds: (A:) Glucuronidase

SCOPe Domain Sequences for d5c70a2:

Sequence; same for both SEQRES and ATOM records:

>d5c70a2 b.1.4.0 (A:181-275) automated matches {Fungus (Aspergillus oryzae) [TaxId: 5062]}
qhiqditvrtdvqgttglidynvvasttqgtiqvavidedgttvatssgsngtihipsvh
lwqpgaaylyqlhasiidsskktidtyklatgirt

Timeline for d5c70a2:

• d5c70a2 first appeared in SCOPe 2.06
  
• d5c70a2 appears in SCOPe 2.07