![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) ![]() |
![]() | Family b.1.4.0: automated matches [254272] (1 protein) not a true family |
![]() | Protein automated matches [254633] (19 species) not a true protein |
![]() | Species Fungus (Aspergillus oryzae) [TaxId:5062] [318527] (2 PDB entries) |
![]() | Domain d5c70a2: 5c70 A:181-275 [318537] Other proteins in same PDB: d5c70a1, d5c70a3, d5c70b1, d5c70b3 automated match to d5czkb2 |
PDB Entry: 5c70 (more details), 3.1 Å
SCOPe Domain Sequences for d5c70a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5c70a2 b.1.4.0 (A:181-275) automated matches {Fungus (Aspergillus oryzae) [TaxId: 5062]} qhiqditvrtdvqgttglidynvvasttqgtiqvavidedgttvatssgsngtihipsvh lwqpgaaylyqlhasiidsskktidtyklatgirt
Timeline for d5c70a2: