Lineage for d1ukea_ (1uke A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2123294Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2123813Protein UMP/CMP kinase [52550] (2 species)
  7. 2123816Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [52551] (6 PDB entries)
  8. 2123822Domain d1ukea_: 1uke A: [31853]
    complexed with mg, up5

Details for d1ukea_

PDB Entry: 1uke (more details), 2.2 Å

PDB Description: ump/cmp kinase from slime mold
PDB Compounds: (A:) uridylmonophosphate/cytidylmonophosphate kinase

SCOPe Domain Sequences for d1ukea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ukea_ c.37.1.1 (A:) UMP/CMP kinase {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
ekskpnvvfvlggpgsgkgtqcanivrdfgwvhlsagdllrqeqqsgskdgemiatmikn
geivpsivtvkllknaidanqgknflvdgfprneennnsweenmkdfvdtkfvlffdcpe
evmtqrllkrgessgrsddniesikkrfntfnvqtklvidhynkfdkvkiipanrdvnev
yndvenlfksmgf

SCOPe Domain Coordinates for d1ukea_:

Click to download the PDB-style file with coordinates for d1ukea_.
(The format of our PDB-style files is described here.)

Timeline for d1ukea_: