Lineage for d1uke__ (1uke -)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 393331Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 393332Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 393333Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (16 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 393606Protein UMP/CMP kinase [52550] (1 species)
  7. 393607Species Dictyostelium discoideum [TaxId:44689] [52551] (6 PDB entries)
  8. 393613Domain d1uke__: 1uke - [31853]
    complexed with mg, up5

Details for d1uke__

PDB Entry: 1uke (more details), 2.2 Å

PDB Description: ump/cmp kinase from slime mold

SCOP Domain Sequences for d1uke__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uke__ c.37.1.1 (-) UMP/CMP kinase {Dictyostelium discoideum}
ekskpnvvfvlggpgsgkgtqcanivrdfgwvhlsagdllrqeqqsgskdgemiatmikn
geivpsivtvkllknaidanqgknflvdgfprneennnsweenmkdfvdtkfvlffdcpe
evmtqrllkrgessgrsddniesikkrfntfnvqtklvidhynkfdkvkiipanrdvnev
yndvenlfksmgf

SCOP Domain Coordinates for d1uke__:

Click to download the PDB-style file with coordinates for d1uke__.
(The format of our PDB-style files is described here.)

Timeline for d1uke__: