Lineage for d1uke__ (1uke -)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) 
Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (12 proteins) 
Protein UMP/CMP kinase [52550] (1 species) Species Dictyostelium discoideum [TaxId:44689] [52551] (6 PDB entries) 
Domain d1uke__: 1uke - [31853]
Details for d1uke__
PDB Entry: 1uke (more details), 2.2 Å
PDB Description: ump/cmp kinase from slime mold
SCOP Domain Sequences for d1uke__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uke__ c.37.1.1 (-) UMP/CMP kinase {Dictyostelium discoideum}
ekskpnvvfvlggpgsgkgtqcanivrdfgwvhlsagdllrqeqqsgskdgemiatmikn
geivpsivtvkllknaidanqgknflvdgfprneennnsweenmkdfvdtkfvlffdcpe
evmtqrllkrgessgrsddniesikkrfntfnvqtklvidhynkfdkvkiipanrdvnev
yndvenlfksmgf
SCOP Domain Coordinates for d1uke__:
Click to download the PDB-style file with coordinates for d1uke__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1uke__:
- d1uke__ first appeared (with stable ids) in SCOP 1.55
- d1uke__ appears in SCOP 1.57
- d1uke__ appears in SCOP 1.61
- d1uke__ appears in the current release, SCOPe 2.08, called d1ukea_
View in 3D