SCOPe 2.08: Domain d5c70b1: 5c70 B:-1-180

Lineage for d5c70b1 (5c70 B:-1-180)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.0: automated matches [191481] (1 protein)
   not a true family

6. Protein automated matches [190770] (51 species)
   not a true protein

7. Species Fungus (Aspergillus oryzae) [TaxId:5062] [256310] (3 PDB entries)

8. Domain d5c70b1: 5c70 B:-1-180 [318526]
   Other proteins in same PDB: d5c70a2, d5c70a3, d5c70b2, d5c70b3
   automated match to d5czkb1

Details for d5c70b1

PDB Entry: 5c70, 3.1 Å

PDB Description: the structure of aspergillus oryzae beta-glucuronidase

PDB Compounds: (B:) Glucuronidase

SCOPe Domain Sequences for d5c70b1:

Sequence; same for both SEQRES and ATOM records:

>d5c70b1 b.18.1.0 (B:-1-180) automated matches {Fungus (Aspergillus oryzae) [TaxId: 5062]}
gsmlkpqqtttrdlisldglwkfalasddnntqpwtsqlktslecpvpasyndifadski
hdhvgwvyyqrdvivpkgwseerylvrceaathhgriyvngnlvadhvggytpfeaditd
lvaageqfrltiavdneltyqtippgkveileatgkkvqtyqhdfynyaglarsvwlysv
pq

Timeline for d5c70b1:

• d5c70b1 first appeared in SCOPe 2.06
  
• d5c70b1 appears in SCOPe 2.07