Lineage for d5jerc_ (5jer C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387735Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. 2387736Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) (S)
    has a few short helices inserted in loops
  5. 2387853Family b.26.1.3: Interferon regulatory factor 3 (IRF3), transactivation domain [101630] (1 protein)
    weak sequence similarity to SMAD domain
  6. 2387854Protein Interferon regulatory factor 3 (IRF3), transactivation domain [101631] (1 species)
  7. 2387855Species Human (Homo sapiens) [TaxId:9606] [101632] (8 PDB entries)
  8. 2387871Domain d5jerc_: 5jer C: [318524]
    automated match to d3a77a_

Details for d5jerc_

PDB Entry: 5jer (more details), 2.91 Å

PDB Description: structure of rotavirus nsp1 bound to irf-3
PDB Compounds: (C:) Interferon regulatory factor 3

SCOPe Domain Sequences for d5jerc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jerc_ b.26.1.3 (C:) Interferon regulatory factor 3 (IRF3), transactivation domain {Human (Homo sapiens) [TaxId: 9606]}
enplkrllvpgeewefevtafyrgrqvfqqtiscpeglrlvgsevgdrtlpgwpvtlpdp
gmsltdrgvmsyvrhvlsclggglalwragqwlwaqrlghchtywavseellpnsghgpd
gevpkdkeggvfdlgpfivdlitftegsgrspryalwfcvgeswpqdqpwtkrlvmvkvv
ptclralvemarvggasslentvdlhisnshplsltsdqykaylqdlvegmdfq

SCOPe Domain Coordinates for d5jerc_:

Click to download the PDB-style file with coordinates for d5jerc_.
(The format of our PDB-style files is described here.)

Timeline for d5jerc_: