Lineage for d2ukd__ (2ukd -)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 581392Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 581393Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) (S)
    division into families based on beta-sheet topologies
  5. 581394Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (18 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 581689Protein UMP/CMP kinase [52550] (2 species)
  7. 581690Species Dictyostelium discoideum [TaxId:44689] [52551] (6 PDB entries)
  8. 581695Domain d2ukd__: 2ukd - [31852]
    complexed with adp, c5p, mg

Details for d2ukd__

PDB Entry: 2ukd (more details), 2.2 Å

PDB Description: ump/cmp kinase from slime mold complexed with adp, cmp

SCOP Domain Sequences for d2ukd__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ukd__ c.37.1.1 (-) UMP/CMP kinase {Dictyostelium discoideum}
skpnvvfvlggpgsgkgtqcanivrdfgwvhlsagdllrqeqqsgskdgemiatmiknge
ivpsivtvkllknaidanqgknflvdgfprneennnsweenmkdfvdtkfvlffdcpeev
mtqrllkrgessgrsddniesikkrfntfnvqtklvidhynkfdkvkiipanrdvnevyn
dvenlfksmgf

SCOP Domain Coordinates for d2ukd__:

Click to download the PDB-style file with coordinates for d2ukd__.
(The format of our PDB-style files is described here.)

Timeline for d2ukd__: