Lineage for d5buwb_ (5buw B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2550604Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2550605Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2551373Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 2551374Protein automated matches [190143] (41 species)
    not a true protein
  7. 2551736Species Yersinia pestis [TaxId:632] [257672] (3 PDB entries)
  8. 2551738Domain d5buwb_: 5buw B: [318516]
    automated match to d4h4ge_
    complexed with edo, scn

Details for d5buwb_

PDB Entry: 5buw (more details), 1.8 Å

PDB Description: crystal structure of beta-hydroxyacyl-acyl carrier protein dehydratase (fabz) from yersinia pestis
PDB Compounds: (B:) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ

SCOPe Domain Sequences for d5buwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5buwb_ d.38.1.0 (B:) automated matches {Yersinia pestis [TaxId: 632]}
thtlhieeildllphrfpfllvdrvldfeegkflravknvsfnepffqghfpgkpifpgv
lileamaqatgilafksrgklepgelyyfagidearfkrpvvpgdqmimevefvkerrgl
trftgvakvdgeivctatmmcars

SCOPe Domain Coordinates for d5buwb_:

Click to download the PDB-style file with coordinates for d5buwb_.
(The format of our PDB-style files is described here.)

Timeline for d5buwb_: