![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
![]() | Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) ![]() |
![]() | Family d.38.1.0: automated matches [191325] (1 protein) not a true family |
![]() | Protein automated matches [190143] (36 species) not a true protein |
![]() | Species Yersinia pestis [TaxId:632] [257672] (3 PDB entries) |
![]() | Domain d5buwb_: 5buw B: [318516] automated match to d4h4ge_ complexed with edo, scn |
PDB Entry: 5buw (more details), 1.8 Å
SCOPe Domain Sequences for d5buwb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5buwb_ d.38.1.0 (B:) automated matches {Yersinia pestis [TaxId: 632]} thtlhieeildllphrfpfllvdrvldfeegkflravknvsfnepffqghfpgkpifpgv lileamaqatgilafksrgklepgelyyfagidearfkrpvvpgdqmimevefvkerrgl trftgvakvdgeivctatmmcars
Timeline for d5buwb_: