SCOPe 2.08: Domain d5ja4b_: 5ja4 B:

Lineage for d5ja4b_ (5ja4 B:)

1. Root: SCOPe 2.08
2. Class a: All alpha proteins [46456] (290 folds)
3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones
4. Superfamily a.22.1: Histone-fold [47113] (5 families)
5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones
6. Protein Histone H4 [47125] (7 species)
7. Species Human (Homo sapiens) [TaxId:9606] [192456] (59 PDB entries)
8. Domain d5ja4b_: 5ja4 B: [318512]
   Other proteins in same PDB: d5ja4a_
   automated match to d1kx5b_
   complexed with gol, mes

Details for d5ja4b_

PDB Entry: 5ja4, 2.42 Å

PDB Description: crystal structure of human tonsl and mcm2 hbds binding to a histone h3-h4 tetramer

PDB Compounds: (B:) histone h4

SCOPe Domain Sequences for d5ja4b_:

Sequence; same for both SEQRES and ATOM records:

>d5ja4b_ a.22.1.1 (B:) Histone H4 {Human (Homo sapiens) [TaxId: 9606]}
kggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavt
ytehakrktvtamdvvyalkrqgrtlygf

SCOPe Domain Coordinates for d5ja4b_ are not available.

Timeline for d5ja4b_:

• d5ja4b_ first appeared in SCOPe 2.06
  
• d5ja4b_ appears in SCOPe 2.07