Lineage for d4ukda_ (4ukd A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2865685Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2866219Protein UMP/CMP kinase [52550] (2 species)
  7. 2866222Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [52551] (6 PDB entries)
  8. 2866224Domain d4ukda_: 4ukd A: [31850]
    complexed with adp, bf2, mg, udp

Details for d4ukda_

PDB Entry: 4ukd (more details), 2 Å

PDB Description: ump/cmp kinase from slime mold complexed with adp, udp, beryllium fluoride
PDB Compounds: (A:) uridylmonophosphate/cytidylmonophosphate kinase

SCOPe Domain Sequences for d4ukda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ukda_ c.37.1.1 (A:) UMP/CMP kinase {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
skpnvvfvlggpgsgkgtqcanivrdfgwvhlsagdllrqeqqsgskdgemiatmiknge
ivpsivtvkllknaidanqgknflvdgfprneennnsweenmkdfvdtkfvlffdcpeev
mtqrllkrgessgrsddniesikkrfntfnvqtklvidhynkfdkvkiipanrdvnevyn
dvenlfksmgf

SCOPe Domain Coordinates for d4ukda_:

Click to download the PDB-style file with coordinates for d4ukda_.
(The format of our PDB-style files is described here.)

Timeline for d4ukda_: