Lineage for d5b2jb_ (5b2j B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2310256Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2310257Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2310258Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2310580Protein Histone H4 [47125] (7 species)
  7. 2310685Species Human (Homo sapiens) [TaxId:9606] [192456] (31 PDB entries)
  8. 2310713Domain d5b2jb_: 5b2j B: [318497]
    Other proteins in same PDB: d5b2ja_, d5b2jc_, d5b2jd_, d5b2je_, d5b2jg_, d5b2jh_
    automated match to d1kx3f_
    protein/DNA complex; complexed with mn

Details for d5b2jb_

PDB Entry: 5b2j (more details), 2.6 Å

PDB Description: human nucleosome containing cpg methylated dna
PDB Compounds: (B:) histone h4

SCOPe Domain Sequences for d5b2jb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b2jb_ a.22.1.1 (B:) Histone H4 {Human (Homo sapiens) [TaxId: 9606]}
vlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrkt
vtamdvvyalkrqgrtlygfgg

SCOPe Domain Coordinates for d5b2jb_:

Click to download the PDB-style file with coordinates for d5b2jb_.
(The format of our PDB-style files is described here.)

Timeline for d5b2jb_: