Lineage for d5ixka_ (5ixk A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2729960Family a.123.1.0: automated matches [191623] (1 protein)
    not a true family
  6. 2729961Protein automated matches [191142] (5 species)
    not a true protein
  7. 2729974Species Human (Homo sapiens) [TaxId:9606] [189274] (121 PDB entries)
  8. 2730105Domain d5ixka_: 5ixk A: [318496]
    automated match to d4zoma_
    complexed with 6ew

Details for d5ixka_

PDB Entry: 5ixk (more details), 2.35 Å

PDB Description: rorgamma in complex with inverse agonist bio399.
PDB Compounds: (A:) Nuclear receptor ROR-gamma

SCOPe Domain Sequences for d5ixka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ixka_ a.123.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhlteai
qyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyggmelf
ralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqynlel
afhhhlckthrqsilaklppkgklrslcsqhverlqifq

SCOPe Domain Coordinates for d5ixka_:

Click to download the PDB-style file with coordinates for d5ixka_.
(The format of our PDB-style files is described here.)

Timeline for d5ixka_: