Lineage for d5hdmb_ (5hdm B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896011Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 2896366Protein automated matches [190152] (25 species)
    not a true protein
  7. 2896508Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [318454] (6 PDB entries)
  8. 2896510Domain d5hdmb_: 5hdm B: [318491]
    automated match to d2gsaa_
    complexed with plp, pmp

Details for d5hdmb_

PDB Entry: 5hdm (more details), 1.25 Å

PDB Description: crystal structure of arabidopsis thaliana glutamate-1-semialdehyde-2, 1-aminomutase
PDB Compounds: (B:) Glutamate-1-semialdehyde 2,1-aminomutase 1, chloroplastic

SCOPe Domain Sequences for d5hdmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hdmb_ c.67.1.4 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
sfslqkseeafnaaknlmpggvnspvrafksvggqpvlidsvkgskmwdidgneyidyvg
swgpaiighaddevlaalaetmkkgtsfgapcllenvlaemvisavpsiemvrfvnsgte
acmgvlrlaraftnkekfikfegcyhghanaflvkagsgvatlglpdspgvpkaatsdtl
tapyndleaveklfaahkgeisavilepvvgnsgfipptpefinglrqltkdngvllifd
evmtgfrlayggaqeyfgitpdlttlgkiiggglpvgayggrrdimemvapagpmyqagt
lsgnplamtagihtlkrlkqagtyeyldkitkeltngileagkktghpmcggyisgmfgf
ffaegpvynfadskksdtekfgrffrgmleegvyfapsqfeagftslahtpediqltiaa
aervlsri

SCOPe Domain Coordinates for d5hdmb_:

Click to download the PDB-style file with coordinates for d5hdmb_.
(The format of our PDB-style files is described here.)

Timeline for d5hdmb_: