SCOPe 2.08: Domain d5f2ra2: 5f2r A:214-407

Lineage for d5f2ra2 (5f2r A:214-407)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (64 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224896] (72 PDB entries)

8. Domain d5f2ra2: 5f2r A:214-407 [318480]
   automated match to d3iucc2
   complexed with acp, mg

Details for d5f2ra2

PDB Entry: 5f2r, 2.15 Å

PDB Description: crystal structure of human grp78 (70kda heat shock protein 5 / bip) atpase domain in complex with amp-pcp

PDB Compounds: (A:) 78 kDa glucose-regulated protein

SCOPe Domain Sequences for d5f2ra2:

Sequence; same for both SEQRES and ATOM records:

>d5f2ra2 c.55.1.0 (A:214-407) automated matches {Human (Homo sapiens) [TaxId: 9606]}
regeknilvfdlgggtfdvslltidngvfevvatngdthlggedfdqrvmehfiklykkk
tgkdvrkdnravqklrrevekakralssqhqarieiesfyegedfsetltrakfeelnmd
lfrstmkpvqkvledsdlkksdideivlvggstripkiqqlvkeffngkepsrginpdea
vaygaavqagvlsg

Timeline for d5f2ra2:

• d5f2ra2 first appeared in SCOPe 2.06
  
• d5f2ra2 appears in SCOPe 2.07