SCOPe 2.08: Domain d5buca_: 5buc A:

Lineage for d5buca_ (5buc A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.3: Quinone reductase [52235] (4 proteins)
   binds FAD

6. Protein Quinone reductase type 2 (menadione reductase) [52240] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52241] (66 PDB entries)

8. Domain d5buca_: 5buc A: [318477]
   automated match to d1qr2a_
   complexed with et, fad, so4, zn

Details for d5buca_

PDB Entry: 5buc, 1.87 Å

PDB Description: oxidized quinone reductase 2 in complex with ethidium

PDB Compounds: (A:) Ribosyldihydronicotinamide dehydrogenase [quinone]

SCOPe Domain Sequences for d5buca_:

Sequence; same for both SEQRES and ATOM records:

>d5buca_ c.23.5.3 (A:) Quinone reductase type 2 (menadione reductase) {Human (Homo sapiens) [TaxId: 9606]}
agkkvlivyahqepksfngslknvavdelsrqgctvtvsdlyamnfepratdkditgtls
npevfnygvetheaykqrslasditdeqkkvreadlvifqfplywfsvpailkgwmdrvl
cqgfafdipgfydsgllqgklallsvttggtaemytktgvngdsryflwplqhgtlhfcg
fkvlapqisfapeiaseeerkgmvaawsqrlqtiwkeepipctahwhfgq

Timeline for d5buca_:

• d5buca_ first appeared in SCOPe 2.06
  
• d5buca_ appears in SCOPe 2.07