| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Llama (Lama glama) [TaxId:9844] [189241] (37 PDB entries) |
| Domain d5f21b_: 5f21 B: [318474] Other proteins in same PDB: d5f21a_ automated match to d4nbzb_ complexed with gol, so4 |
PDB Entry: 5f21 (more details), 1.9 Å
SCOPe Domain Sequences for d5f21b_:
Sequence, based on SEQRES records: (download)
>d5f21b_ b.1.1.0 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qlqesgggsvqaggsltlsctasgllfrlasmgwyrqapgkereliatitvggktnykds
vqgrfiitrdntgdntkstvtlqmnrlkpedtavyycntaspavgadtwgqgtrvtvs
>d5f21b_ b.1.1.0 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qlqesgggsvqaggsltlsctasgllfrlasmgwyrqapgkereliatitvggktnykds
vqgrfiitrdntkstvtlqmnrlkpedtavyycntaspavgadtwgqgtrvtvs
Timeline for d5f21b_: