Lineage for d5bxna_ (5bxn A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2594772Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2597201Protein Proteasome beta subunit (catalytic) [56252] (7 species)
  7. 2597210Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (202 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2598977Domain d5bxna_: 5bxn A: [318471]
    Other proteins in same PDB: d5bxnb_, d5bxnc_, d5bxnd_, d5bxne_, d5bxnf_, d5bxng_, d5bxnh_, d5bxnm_, d5bxnp_, d5bxnq_, d5bxnr_, d5bxns_, d5bxnt_, d5bxnu_, d5bxnv_
    automated match to d1jd2v_
    complexed with bo2, cl, mg; mutant

Details for d5bxna_

PDB Entry: 5bxn (more details), 2.8 Å

PDB Description: yeast 20s proteasome beta2-g170a mutant in complex with bortezomib
PDB Compounds: (A:) Proteasome subunit alpha type-2

SCOPe Domain Sequences for d5bxna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bxna_ d.153.1.4 (A:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mtdrysfslttfspsgklgqidyaltavkqgvtslgikatngvviatekksssplamset
lskvslltpdigavysgmgpdyrvlvdksrkvahtsykriygeypptkllvsevakimqe
atqsggvrpfgvslliaghdefngfslyqvdpsgsyfpwkataigkgsvaaktflekrwn
deleledaihialltlkesvegefngdtielaiigdenpdllgytgiptdkgprfrklts
qeindrleal

SCOPe Domain Coordinates for d5bxna_:

Click to download the PDB-style file with coordinates for d5bxna_.
(The format of our PDB-style files is described here.)

Timeline for d5bxna_: