Lineage for d2cmka_ (2cmk A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1362078Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1362079Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1362080Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 1362148Protein CMP kinase [52548] (3 species)
  7. 1362149Species Escherichia coli [TaxId:562] [52549] (6 PDB entries)
  8. 1362155Domain d2cmka_: 2cmk A: [31847]
    complexed with cdp, so4

Details for d2cmka_

PDB Entry: 2cmk (more details), 2 Å

PDB Description: cytidine monophosphate kinase in complex with cytidine-di-phosphate
PDB Compounds: (A:) protein (cytidine monophosphate kinase)

SCOPe Domain Sequences for d2cmka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cmka_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]}
aiapvitidgpsgagkgtlckamaealqwhlldsgaiyrvlalaalhhhvdvasedalvp
lashldvrfvstngnlevilegedvsgeirtqevanaasqvaafprvreallrrqrafre
lpgliadgrdmgtvvfpdapvkifldasseerahrrmlqlqekgfsvnferllaeikerd
drdrnravaplvpaadalvldsttlsieqviekalqyarqk

SCOPe Domain Coordinates for d2cmka_:

Click to download the PDB-style file with coordinates for d2cmka_.
(The format of our PDB-style files is described here.)

Timeline for d2cmka_: