Lineage for d2cmka_ (2cmk A:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 179162Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 179163Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) (S)
  5. 179164Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (15 proteins)
  6. 179207Protein CMP kinase [52548] (1 species)
  7. 179208Species Escherichia coli [TaxId:562] [52549] (6 PDB entries)
  8. 179214Domain d2cmka_: 2cmk A: [31847]

Details for d2cmka_

PDB Entry: 2cmk (more details), 2 Å

PDB Description: cytidine monophosphate kinase in complex with cytidine-di-phosphate

SCOP Domain Sequences for d2cmka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cmka_ c.37.1.1 (A:) CMP kinase {Escherichia coli}
aiapvitidgpsgagkgtlckamaealqwhlldsgaiyrvlalaalhhhvdvasedalvp
lashldvrfvstngnlevilegedvsgeirtqevanaasqvaafprvreallrrqrafre
lpgliadgrdmgtvvfpdapvkifldasseerahrrmlqlqekgfsvnferllaeikerd
drdrnravaplvpaadalvldsttlsieqviekalqyarqk

SCOP Domain Coordinates for d2cmka_:

Click to download the PDB-style file with coordinates for d2cmka_.
(The format of our PDB-style files is described here.)

Timeline for d2cmka_: