SCOPe 2.07: Domain d5bywb_: 5byw B:

Lineage for d5bywb_ (5byw B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (93 species)
   not a true protein

7. Species Clostridium thermocellum [TaxId:203119] [269902] (4 PDB entries)

8. Domain d5bywb_: 5byw B: [318461]
   automated match to d3amda_

Details for d5bywb_

PDB Entry: 5byw, 2.6 Å

PDB Description: crystal structure of engineered trifunctional ctcel5e

PDB Compounds: (B:) endoglucanase h

SCOPe Domain Sequences for d5bywb_:

Sequence; same for both SEQRES and ATOM records:

>d5bywb_ c.1.8.0 (B:) automated matches {Clostridium thermocellum [TaxId: 203119]}
vdpfemvrkmgmgtnlgntleapyegswsksameyyfddfkaagyknvripvrwdnhtmr
typytidkafldrveqvvdwslsrgfvtiinshhddwikedyngnierfekiweqiaerf
knksenllfeimnepfgnitdeqiddmnsrilkiirktnptriviigggywnsyntlvni
kipddpyligtahyydpfefthqgaewvegsekwlgrkwgtqedmdtvvrvfdfvkswsd
rnnipvyfgefavmayadrtsrvkwydfisdaalergfacsvwdngvfgsldndmaiynr
dtrtfdteilnalfnp

Timeline for d5bywb_:

• d5bywb_ first appeared in SCOPe 2.06