![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
![]() | Protein automated matches [190075] (93 species) not a true protein |
![]() | Species Clostridium thermocellum [TaxId:203119] [269902] (4 PDB entries) |
![]() | Domain d5bywb_: 5byw B: [318461] automated match to d3amda_ |
PDB Entry: 5byw (more details), 2.6 Å
SCOPe Domain Sequences for d5bywb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5bywb_ c.1.8.0 (B:) automated matches {Clostridium thermocellum [TaxId: 203119]} vdpfemvrkmgmgtnlgntleapyegswsksameyyfddfkaagyknvripvrwdnhtmr typytidkafldrveqvvdwslsrgfvtiinshhddwikedyngnierfekiweqiaerf knksenllfeimnepfgnitdeqiddmnsrilkiirktnptriviigggywnsyntlvni kipddpyligtahyydpfefthqgaewvegsekwlgrkwgtqedmdtvvrvfdfvkswsd rnnipvyfgefavmayadrtsrvkwydfisdaalergfacsvwdngvfgsldndmaiynr dtrtfdteilnalfnp
Timeline for d5bywb_:
![]() Domains from other chains: (mouse over for more information) d5bywa_, d5bywc_, d5bywd_, d5bywe_ |