SCOPe 2.08: Domain d5acbb2: 5acb B:158-267

Lineage for d5acbb2 (5acb B:158-267)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein automated matches [227027] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225840] (19 PDB entries)

8. Domain d5acbb2: 5acb B:158-267 [318453]
   Other proteins in same PDB: d5acbc_, d5acbd_
   automated match to d2i53a2
   complexed with 5i1

Details for d5acbb2

PDB Entry: 5acb, 2.7 Å

PDB Description: crystal structure of the human cdk12-cyclink complex

PDB Compounds: (B:) cyclin-k

SCOPe Domain Sequences for d5acbb2:

Sequence; same for both SEQRES and ATOM records:

>d5acbb2 a.74.1.1 (B:158-267) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ehpyqfllkyakqlkgdknkiqklvqmawtfvndslcttlslqwepeiiavavmylagrl
ckfeiqewtskpmyrrwweqfvqdvpvdvledichqildlysqgkqqmph

Timeline for d5acbb2:

• d5acbb2 first appeared in SCOPe 2.06
  
• d5acbb2 appears in SCOPe 2.07