Lineage for d5f1kd_ (5f1k D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759403Species Llama (Lama glama) [TaxId:9844] [189241] (37 PDB entries)
  8. 2759432Domain d5f1kd_: 5f1k D: [318450]
    Other proteins in same PDB: d5f1ka_, d5f1kb_
    automated match to d4nbzb_

Details for d5f1kd_

PDB Entry: 5f1k (more details), 2.3 Å

PDB Description: human cd38 in complex with nanobody mu1053
PDB Compounds: (D:) nanobody MU1053

SCOPe Domain Sequences for d5f1kd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5f1kd_ b.1.1.0 (D:) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlqesggglvqaggslrlsctgsgrtfrnypmawfrqapgkerefvagitwvgastlya
dfakgrftisrdnakntvylqmnslkpedtavyscaagrgivagripaeyadwgqgtqvt
vss

SCOPe Domain Coordinates for d5f1kd_:

Click to download the PDB-style file with coordinates for d5f1kd_.
(The format of our PDB-style files is described here.)

Timeline for d5f1kd_: