![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (31 species) not a true protein |
![]() | Species Llama (Lama glama) [TaxId:9844] [189241] (37 PDB entries) |
![]() | Domain d5f1kc_: 5f1k C: [318449] Other proteins in same PDB: d5f1ka_, d5f1kb_ automated match to d4nbzb_ |
PDB Entry: 5f1k (more details), 2.3 Å
SCOPe Domain Sequences for d5f1kc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5f1kc_ b.1.1.0 (C:) automated matches {Llama (Lama glama) [TaxId: 9844]} vqlqesggglvqaggslrlsctgsgrtfrnypmawfrqapgkerefvagitwvgastlya dfakgrftisrdnakntvylqmnslkpedtavyscaagrgivagripaeyadwgqgtqvt vss
Timeline for d5f1kc_: