Lineage for d1dela_ (1del A:)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) 
Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (12 proteins) 
Protein Deoxynucleoside monophosphate kinase [52546] (1 species) Species Bacteriophage T4 [TaxId:10665] [52547] (2 PDB entries) 
Domain d1dela_: 1del A: [31844]
Details for d1dela_
PDB Entry: 1del (more details), 2.2 Å
PDB Description: deoxynucleoside monophosphate kinase complexed with deoxy-gmp and amp
SCOP Domain Sequences for d1dela_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dela_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4}
mkliflsgvkrsgkdttadfimsnysavkyqlagpikdalayawgvfaantdypcltrke
fegidydretnlnltklevitimeqafcylngkspikgvfvfddegkesvnfvafnkitd
vinniedqwsvrrlmqalgtdlivnnfdrmywvklfaldyldkfnsgydyyivpdtrqdh
emdaaramgatvihvvrpgqksndthiteaglpirdgdlvitndgsleelfskikntlkv
l
SCOP Domain Coordinates for d1dela_:
Click to download the PDB-style file with coordinates for d1dela_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dela_:
- d1dela_ first appeared (with stable ids) in SCOP 1.55
- d1dela_ appears in SCOP 1.57
- d1dela_ appears in SCOP 1.61
- d1dela_ appears in the current release, SCOPe 2.08
View in 3D
