| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (4 families) ![]() duplication: consists of two domains of this fold |
| Family a.74.1.1: Cyclin [47955] (9 proteins) |
| Protein automated matches [227027] (3 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [225840] (19 PDB entries) |
| Domain d5acba2: 5acb A:158-260 [318435] Other proteins in same PDB: d5acbc_, d5acbd_ automated match to d2i53a2 complexed with 5i1 |
PDB Entry: 5acb (more details), 2.7 Å
SCOPe Domain Sequences for d5acba2:
Sequence, based on SEQRES records: (download)
>d5acba2 a.74.1.1 (A:158-260) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ehpyqfllkyakqlkgdknkiqklvqmawtfvndslcttlslqwepeiiavavmylagrl
ckfeiqewtskpmyrrwweqfvqdvpvdvledichqildlysq
>d5acba2 a.74.1.1 (A:158-260) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ehpyqfllkyakqlkgdknkiqklvqmawtfvndslcttlslqwepeiiavavmylagrl
ckfeiqewtsrrwweqfvqdvpvdvledichqildlysq
Timeline for d5acba2:
View in 3DDomains from other chains: (mouse over for more information) d5acbb1, d5acbb2, d5acbc_, d5acbd_ |