Lineage for d1deka_ (1dek A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. Protein Deoxynucleoside monophosphate kinase [52546] (1 species)
    contains insert 4-helical bundle subdomain, residues 35-145
  7. Species Bacteriophage T4 [TaxId:10665] [52547] (2 PDB entries)
  8. Domain d1deka_: 1dek A: [31842]
    complexed with dgp, mg
    has additional subdomain(s) that are not in the common domain

Details for d1deka_

PDB Entry: 1dek (more details), 2 Å

PDB Description: deoxynucleoside monophosphate kinase complexed with deoxy-gmp
PDB Compounds: (A:) deoxynucleoside monophosphate kinase

SCOPe Domain Sequences for d1deka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]}
mkliflsgvkrsgkdttadfimsnysavkyqlagpikdalayawgvfaantdypcltrke
fegidydretnlnltklevitimeqafcylngkspikgvfvfddegkesvnfvafnkitd
vinniedqwsvrrlmqalgtdlivnnfdrmywvklfaldyldkfnsgydyyivpdtrqdh
emdaaramgatvihvvrpgqksndthiteaglpirdgdlvitndgsleelfskikntlkv
l

SCOPe Domain Coordinates for d1deka_ are not available.

Timeline for d1deka_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dekb_