Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins) parallel beta-sheet of 5 strands, order 23145 |
Protein Uridylate kinase [52544] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52545] (2 PDB entries) |
Domain d1ukya_: 1uky A: [31841] complexed with adp |
PDB Entry: 1uky (more details), 2.13 Å
SCOPe Domain Sequences for d1ukya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ukya_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} pafspdqvsvifvlggpgagkgtqceklvkdysfvhlsagdllraeqgragsqygelikn cikegqivpqeitlallrnaisdnvkankhkflidgfprkmdqaisferdiveskfilff dcpedimlerllergktsgrsddniesikkrfntfketsmpvieyfetkskvvrvrcdrs vedvykdvqdairdsl
Timeline for d1ukya_: