SCOPe 2.08: Domain d5f1ob_: 5f1o B:

Lineage for d5f1ob_ (5f1o B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [189241] (37 PDB entries)

8. Domain d5f1ob_: 5f1o B: [318404]
   Other proteins in same PDB: d5f1oa_
   automated match to d4nbzb_

Details for d5f1ob_

PDB Entry: 5f1o, 2.2 Å

PDB Description: human cd38 in complex with nanobody mu551

PDB Compounds: (B:) nanobody MU551

SCOPe Domain Sequences for d5f1ob_:

Sequence; same for both SEQRES and ATOM records:

>d5f1ob_ b.1.1.0 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]}
dvqlqesggglvqaghslrlscvgsgsrfdnyamgwfrqapgkerefvaaiswssgttry
ldtvkgrftisrdnakstvylqmnslkpedtavyycaaryqpryydsgdmdgyeydnwgq
gtqvtvss

Timeline for d5f1ob_:

• d5f1ob_ first appeared in SCOPe 2.06
  
• d5f1ob_ appears in SCOPe 2.07