Lineage for d5evzb1 (5evz B:26-213)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2884835Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2884836Protein automated matches [226839] (64 species)
    not a true protein
  7. 2885061Species Human (Homo sapiens) [TaxId:9606] [224896] (72 PDB entries)
  8. 2885128Domain d5evzb1: 5evz B:26-213 [318383]
    automated match to d3iucc1
    complexed with adp, mg, po4

Details for d5evzb1

PDB Entry: 5evz (more details), 1.85 Å

PDB Description: crystal structure of human grp78 (70kda heat shock protein 5 / bip) atpase domain in complex with adp and inorganic phosphate
PDB Compounds: (B:) 78 kDa glucose-regulated protein

SCOPe Domain Sequences for d5evzb1:

Sequence, based on SEQRES records: (download)

>d5evzb1 c.55.1.0 (B:26-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvgtvvgidlgttyscvgvfkngrveiiandqgnritpsyvaftpegerligdaaknqlt
snpentvfdakrligrtwndpsvqqdikflpfkvvekktkpyiqvdigggqtktfapeei
samvltkmketaeaylgkkvthavvtvpayfndaqrqatkdagtiaglnvmriineptaa
aiaygldk

Sequence, based on observed residues (ATOM records): (download)

>d5evzb1 c.55.1.0 (B:26-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvgtvvgidlgttyscvgvfkngrveiiandqgnritpsyvaftpegerligdaaknqts
npentvfdakrligrtwndpsvqqdikflpfkvvekktkpyiqvdigggqtktfapeeis
amvltkmketaeaylgkkvthavvtvpayfndaqrqatkdagtiaglnvmriineptaaa
iaygldk

SCOPe Domain Coordinates for d5evzb1:

Click to download the PDB-style file with coordinates for d5evzb1.
(The format of our PDB-style files is described here.)

Timeline for d5evzb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5evzb2