Lineage for d5f1ka_ (5f1k A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2438294Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2440985Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (4 families) (S)
    there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members
  5. 2441029Family c.23.14.3: ADP ribosyl cyclase-like [56630] (3 protein domains)
    contains extra N-terminal all-alpha subdomain
    automatically mapped to Pfam PF02267
  6. 2441030Protein ADP ribosyl cyclase [56631] (4 species)
  7. 2441055Species Human (Homo sapiens) [TaxId:9606] [159490] (42 PDB entries)
    Uniprot P28907 45-291
  8. 2441136Domain d5f1ka_: 5f1k A: [318382]
    Other proteins in same PDB: d5f1kc_, d5f1kd_
    automated match to d1zvmc_

Details for d5f1ka_

PDB Entry: 5f1k (more details), 2.3 Å

PDB Description: human cd38 in complex with nanobody mu1053
PDB Compounds: (A:) ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1

SCOPe Domain Sequences for d5f1ka_:

Sequence, based on SEQRES records: (download)

>d5f1ka_ c.23.14.3 (A:) ADP ribosyl cyclase {Human (Homo sapiens) [TaxId: 9606]}
twsgpgttkrfpetvlarcvkyteihpemrhvdcqsvwdafkgafiskhpcditeedyqp
lmklgtqtvpcnkillwsrikdlahqftqvqrdmftledtllgyladdltwcgefdtski
nyqscpdwrkdcsnnpvsvfwktvsrrfaeaacdvvhvmldgsrskifdkdstfgsvevh
nlqpekvqtleawvihggredsrdlcqdptikelesiiskrniqfsckniyrpdkflqcv
knpedssc

Sequence, based on observed residues (ATOM records): (download)

>d5f1ka_ c.23.14.3 (A:) ADP ribosyl cyclase {Human (Homo sapiens) [TaxId: 9606]}
twsgpgttkrfpetvlarcvkyteihpemrhvdcqsvwdafkgafiskhpcditeedyqp
lmklgtqtvpcnkillwsrikdlahqftqvqrdmftledtllgyladdltwcgefdtski
nyqscpdwrkdcsnnpvsvfwktvsrrfaeaacdvvhvmldgsrskifdkdstfgsvevh
nlqpekvqtleawvihggrdlcqdptikelesiiskrniqfsckniyrpdkflqcvknpe
dssc

SCOPe Domain Coordinates for d5f1ka_:

Click to download the PDB-style file with coordinates for d5f1ka_.
(The format of our PDB-style files is described here.)

Timeline for d5f1ka_: