Lineage for d5exwa1 (5exw A:27-213)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2884835Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2884836Protein automated matches [226839] (64 species)
    not a true protein
  7. 2885061Species Human (Homo sapiens) [TaxId:9606] [224896] (72 PDB entries)
  8. 2885154Domain d5exwa1: 5exw A:27-213 [318373]
    automated match to d3iucc1
    complexed with 7dt

Details for d5exwa1

PDB Entry: 5exw (more details), 1.9 Å

PDB Description: crystal structure of human grp78 (70kda heat shock protein 5 / bip) atpase domain in complex with 7-deaza-atp
PDB Compounds: (A:) 78 kDa glucose-regulated protein

SCOPe Domain Sequences for d5exwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5exwa1 c.55.1.0 (A:27-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vgtvvgidlgttyscvgvfkngrveiiandqgnritpsyvaftpegerligdaaknqlts
npentvfdakrligrtwndpsvqqdikflpfkvvekktkpyiqvdigggqtktfapeeis
amvltkmketaeaylgkkvthavvtvpayfndaqrqatkdagtiaglnvmriineptaaa
iaygldk

SCOPe Domain Coordinates for d5exwa1:

Click to download the PDB-style file with coordinates for d5exwa1.
(The format of our PDB-style files is described here.)

Timeline for d5exwa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5exwa2